Restricted catalogue
Advanced Biotech supplies reference compounds exclusively to qualified researchers and laboratories for in vitro and analytical use. Please confirm the statements below before continuing.
All materials supplied by Advanced Biotech are sold strictly for laboratory, analytical, educational, and in vitro research purposes. They are not drugs, foods, cosmetics, or medical devices, and may not be labeled, represented, or used as such. Not for human or veterinary use. Not for use in diagnostic procedures. These materials have not been evaluated by the U.S. Food and Drug Administration. Advanced Biotech is a supplier of research materials and is not a pharmacy or a compounding facility.
$90.00
Reference compound supplied as a lyophilised powder for in vitro research.
In stock
All materials supplied by Advanced Biotech are sold strictly for laboratory, analytical, educational, and in vitro research purposes. They are not drugs, foods, cosmetics, or medical devices, and may not be labeled, represented, or used as such. Not for human or veterinary use. Not for use in diagnostic procedures. These materials have not been evaluated by the U.S. Food and Drug Administration. Advanced Biotech is a supplier of research materials and is not a pharmacy or a compounding facility.
Tesamorelin 10 mg is supplied as a characterised reference material in a 10 mg presentation for laboratory and in vitro research. The synthesis batch it is drawn from was analysed by an independent laboratory for identity, purity, and net content, and that certificate is published against the lot number printed on the vial.
| CAS number | 218949-48-5 |
|---|---|
| Molecular formula | C221H366N72O67S |
| Molecular weight | 5135.9 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 aa); N-terminal Tyr1 trans-3-hexenoylated; C-terminal Leu44 amide |
| Research amount | 10 mg |
| Physical form | Lyophilised powder |
| Released purity | ≥ 99.93% |
| Released lot | AB-2609-002 |
| Storage | Store lyophilised at -20 °C, desiccated and protected from light |
Characterisation data reflects the current released lot. Lot-specific documentation is available from the verification portal.
| Lyophilised material, unopened | -20 °C, desiccated and protected from light |
|---|---|
| Short-term handling | 2–8 °C for periods measured in days, not weeks |
| In transit | Brief ambient excursion is tolerated by lyophilised material; refrigerate on arrival |
| Reconstituted solution | 2–8 °C, protected from light; avoid repeated freeze-thaw cycling |
| Solvent selection | Bacteriostatic water suits most sequences; hydrophobic and highly basic sequences may require dilute acetic acid to achieve a clear solution |
| Aliquoting | Divide into single-use volumes before freezing to avoid cycling the whole stock |
Handling guidance applies to laboratory research materials and is not instruction for any use in humans or animals.
| Lot | Purity | Released |
|---|---|---|
| AB-2609-002 | 99.93% | 2026-09-08 |
Most research workflows need a diluent on hand. Add one now and it ships in the same box.
Acetic Acid 10 ml$15.00Add
BAC Water 10 ml$15.00Add
Research use only
Add to order
Research use only
Add to order
Research use only
Add to order
Research use only
Add to order